PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0095s0240.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Dof
Protein Properties Length: 339aa    MW: 35793 Da    PI: 9.2227
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0095s0240.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1245e-3973132362
                  zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                             e alkcprC+stntkfCy+nnysl+qPr+fCk+CrryWt+GGalrnvPvGgg+r+nk+s+
  SapurV1A.0095s0240.1.p  73 EMALKCPRCESTNTKFCYFNNYSLTQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKRSK 132
                             6689*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-3156121IPR003851Zinc finger, Dof-type
PfamPF027011.4E-3275130IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.54476130IPR003851Zinc finger, Dof-type
PROSITE patternPS01361078114IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MVFSSIPVYL DPPNWQQQHN NQPPAGVGNE NHQLPPPPAP PTSGGDGGGT TAGSIRPGSM  60
TDRARLAKIP LPEMALKCPR CESTNTKFCY FNNYSLTQPR HFCKTCRRYW TRGGALRNVP  120
VGGGCRRNKR SKGSGRSKSP VKAGSSSSGG LASNGCTTDL TGNMPAPPPL LPIFPPLHHL  180
GDYNSQDIGL NFGGIQPSVG AIAGGGGGVG YQMDNSTSSN SVGGSVLSSG LVEQWRLQQM  240
QHQVQQFPFL SNMEPPSGLY SFETGGIGPS NYAGQIRSKP LDSSGVITQL ASVKMEENQG  300
LNLSRNFLGI SGNDQYWGGN NAWTDLPGFT SSSTSHLL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00407DAPTransfer from AT3G55370Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011027185.10.0PREDICTED: dof zinc finger protein DOF3.6-like isoform X2
SwissprotQ9M2U15e-78DOF36_ARATH; Dof zinc finger protein DOF3.6
TrEMBLB9NBE61e-177B9NBE6_POPTR; Uncharacterized protein
STRINGPOPTR_0010s21240.11e-177(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65634143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.28e-45OBF-binding protein 3